(data stored in ACNUC7421 zone)

EMBL: CP001854.PE220

CP001854.PE220       Location/Qualifiers
FT   CDS             223227..223991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48656"
FT                   /db_xref="GOA:D3F578"
FT                   /db_xref="UniProtKB/TrEMBL:D3F578"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48656.1"
FT                   /translation="MTAVIISLDLVQTNAEPGRESAFLVLLAFLCSFGFIRTSARLTRS
FT                   VSWWPGGVQTEGGVHLHHLVWGIVLLLVSGFAAFATDLVAPWWQITSIAFGIGAGFTLD
FT                   EFALWVRLQDVYWSDEGRASLDAVVLATVFAGLVVFGVNPYGLDEAGSIVGTAAWFALT
FT                   LAFAGIAFFKGRMVLGMVAIFVPFVAGAWAAVRLAKPTSPWARRYDADKLARARARYGP
FT                   DTRGARFGRRFLDAIGGAPSEPDPPGPPARPG"
     MTAVIISLDL VQTNAEPGRE SAFLVLLAFL CSFGFIRTSA RLTRSVSWWP GGVQTEGGVH        60
     LHHLVWGIVL LLVSGFAAFA TDLVAPWWQI TSIAFGIGAG FTLDEFALWV RLQDVYWSDE       120
     GRASLDAVVL ATVFAGLVVF GVNPYGLDEA GSIVGTAAWF ALTLAFAGIA FFKGRMVLGM       180
     VAIFVPFVAG AWAAVRLAKP TSPWARRYDA DKLARARARY GPDTRGARFG RRFLDAIGGA       240
     PSEPDPPGPP ARPG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page