(data stored in ACNUC7421 zone)

EMBL: CP001854.PE221

CP001854.PE221       Location/Qualifiers
FT   CDS             complement(223999..225342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0221"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mxa:MXAN_0560 penicillin-resistant dd- carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48657"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3F579"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADB48657.1"
FT                   /translation="MNQEQRDLALDDLWADSLERSLARRGARPRTSSALARLRPRDLAD
FT                   AEFSLDSLMVAQRRREAAAAQTKLPAPAKRGLSLTALLAVTAGPAVGVGGAFTGTAAAA
FT                   PRVALEKGDRGRQVKQLQRALGVHADGIFGPGTKKALRKFQARHGLDVDGVAGSATWSA
FT                   LKRADANTARTSARSGGKKDRIIGHSVRAVQRELGVPADGVFGPQSIKALRKFQDRHGL
FT                   DVDGVVGPATWSALKRDGGGNAGGGRRARSATNEGSGVAALQRALGIAADGEFGPGTEA
FT                   AVKRYQASRGLEADGVAGPATRDALGLGDGPVLKRGGEGRRGGGGSNADAKVAAMIAAG
FT                   NRIATTPYVYGGGHGSFQDSGYDCSGSVSYVLNAGGFLDSPLASGGLMSWGEAGEGKRV
FT                   TVYSNPGHAYMVIDGRRFDTSGQSSAGTRWQANDRSTAGYVARHPAGL"
     MNQEQRDLAL DDLWADSLER SLARRGARPR TSSALARLRP RDLADAEFSL DSLMVAQRRR        60
     EAAAAQTKLP APAKRGLSLT ALLAVTAGPA VGVGGAFTGT AAAAPRVALE KGDRGRQVKQ       120
     LQRALGVHAD GIFGPGTKKA LRKFQARHGL DVDGVAGSAT WSALKRADAN TARTSARSGG       180
     KKDRIIGHSV RAVQRELGVP ADGVFGPQSI KALRKFQDRH GLDVDGVVGP ATWSALKRDG       240
     GGNAGGGRRA RSATNEGSGV AALQRALGIA ADGEFGPGTE AAVKRYQASR GLEADGVAGP       300
     ATRDALGLGD GPVLKRGGEG RRGGGGSNAD AKVAAMIAAG NRIATTPYVY GGGHGSFQDS       360
     GYDCSGSVSY VLNAGGFLDS PLASGGLMSW GEAGEGKRVT VYSNPGHAYM VIDGRRFDTS       420
     GQSSAGTRWQ ANDRSTAGYV ARHPAGL                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page