(data stored in ACNUC7421 zone)

EMBL: CP001854.PE222

CP001854.PE222       Location/Qualifiers
FT   CDS             225601..226401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0222"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; putative RNA
FT                   methylase; KEGG: afw:Anae109_1601 methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48658"
FT                   /db_xref="GOA:D3F5Y5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48658.1"
FT                   /translation="MTGRGGIWALGDFAKVARETITGTGDVLVEACGIGPGQRVLDVAA
FT                   GSGNVAIPAARAGADVVASDITPELLEAGRAEAAQQGVTLEWVEADAQALPFDDDAFDV
FT                   VTSSFGVMFAPDQPAAAAELVRVCRPGGTIGLVNWTPGSWVAQFFATLLPFRPPPPPGF
FT                   QPPVMWGEESHLRELLGAGIETLRTERHTVVVDRFPDPAAIVSYYAAYFGPVVAARAAL
FT                   GDDPTRLAELDRALLELAERTDGGPPGGPARYELEYLLAVARVT"
     MTGRGGIWAL GDFAKVARET ITGTGDVLVE ACGIGPGQRV LDVAAGSGNV AIPAARAGAD        60
     VVASDITPEL LEAGRAEAAQ QGVTLEWVEA DAQALPFDDD AFDVVTSSFG VMFAPDQPAA       120
     AAELVRVCRP GGTIGLVNWT PGSWVAQFFA TLLPFRPPPP PGFQPPVMWG EESHLRELLG       180
     AGIETLRTER HTVVVDRFPD PAAIVSYYAA YFGPVVAARA ALGDDPTRLA ELDRALLELA       240
     ERTDGGPPGG PARYELEYLL AVARVT                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page