(data stored in ACNUC7421 zone)

EMBL: CP001854.PE223

CP001854.PE223       Location/Qualifiers
FT   CDS             complement(226425..227693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0223"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gur:Gura_3474 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48659"
FT                   /db_xref="GOA:D3F5Y6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADB48659.1"
FT                   /translation="MSGTAVRRPPRRPPRLRPRRSRRAHDAERLPASRLLPADVMRLGA
FT                   HGLRTRPARAALSALGIAIGVAAMVAVLGVGESSRTRVLDQLAKLGTNLLTVQPGESFF
FT                   GEEVKLPETAARSIRGLPGVEVAAAATTLSQTVRKTDRVPEEESNGIALTAAEPGLLEA
FT                   IGGSLASGRFLDAALARYEAIVLGSLTARRLGIERPGPRVYVGDRWFTVVGIMRPVPLV
FT                   GDLDRAAFIGYPVAKRLFGADRSASAIYVRTREDAVIDTRALLGPTANPQRPEEVAVSR
FT                   PSDALAAKAATEDALTALLLGLGAVALLVGGIGIANVMVIAVLERRREIGLRRALGATR
FT                   RHVAVQFLCEALLLSLLGGALGVLLGAAGTFAYATSQDVRTVIPAIAIVGGLLASVGMG
FT                   AIAGFYPALRATRLSPTEALRST"
     MSGTAVRRPP RRPPRLRPRR SRRAHDAERL PASRLLPADV MRLGAHGLRT RPARAALSAL        60
     GIAIGVAAMV AVLGVGESSR TRVLDQLAKL GTNLLTVQPG ESFFGEEVKL PETAARSIRG       120
     LPGVEVAAAA TTLSQTVRKT DRVPEEESNG IALTAAEPGL LEAIGGSLAS GRFLDAALAR       180
     YEAIVLGSLT ARRLGIERPG PRVYVGDRWF TVVGIMRPVP LVGDLDRAAF IGYPVAKRLF       240
     GADRSASAIY VRTREDAVID TRALLGPTAN PQRPEEVAVS RPSDALAAKA ATEDALTALL       300
     LGLGAVALLV GGIGIANVMV IAVLERRREI GLRRALGATR RHVAVQFLCE ALLLSLLGGA       360
     LGVLLGAAGT FAYATSQDVR TVIPAIAIVG GLLASVGMGA IAGFYPALRA TRLSPTEALR       420
     ST                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page