(data stored in ACNUC7421 zone)

EMBL: CP001854.PE224

CP001854.PE224       Location/Qualifiers
FT   CDS             complement(227690..228346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0224"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_02834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48660"
FT                   /db_xref="GOA:D3F5Y7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48660.1"
FT                   /translation="MTPVLELDHVTKTYPGVTALDDVSLRIDAGELIAIVGPSGSGKST
FT                   LLQIMGTLDRPTDGRVLIEGRDAAECDDGELAALRARRIGFVFQQFFLLDGASALDNVA
FT                   DGLLYTGTPRAQRRERAADALERVGLAARAHHAPNALSGGERQRVGIARAIVAKPAIVL
FT                   ADEPTGALDSARGAEIVALMRELNDAGTTLAIITHDRELAGGLPRQVSVRDGRLS"
     MTPVLELDHV TKTYPGVTAL DDVSLRIDAG ELIAIVGPSG SGKSTLLQIM GTLDRPTDGR        60
     VLIEGRDAAE CDDGELAALR ARRIGFVFQQ FFLLDGASAL DNVADGLLYT GTPRAQRRER       120
     AADALERVGL AARAHHAPNA LSGGERQRVG IARAIVAKPA IVLADEPTGA LDSARGAEIV       180
     ALMRELNDAG TTLAIITHDR ELAGGLPRQV SVRDGRLS                               218
//

If you have problems or comments...

PBIL Back to PBIL home page