(data stored in ACNUC7421 zone)

EMBL: CP001854.PE225

CP001854.PE225       Location/Qualifiers
FT   CDS             complement(228343..230160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0225"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   predicted gene, 100041170"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48661"
FT                   /db_xref="GOA:D3F5Y8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y8"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADB48661.1"
FT                   /translation="MRRGDHADGSHVPGEVTRRRAAVGIALPLAALAAVAAVVIASSGG
FT                   SGASGGSASASTTPMGTARVERRTLVEQKALDGTLGYDDPQPAVDRLGGTLTWLPRTGA
FT                   TIRPGQRLFSVDGEPVVLMDGTVPAWRTLKEGIDDGEDVRQLEQNLAALGYDPGTVDDD
FT                   FTSSTADAVERWQDAWDLKETGEVELGRIVFLPGARRIAEVKGSLGGTGGSSGGGGDSV
FT                   AWDGGSAAGGLRTMAVSDMSSGGAPVAAATGTSTTPAPGATTPADPGNGTGGTGGTGGT
FT                   GGDGGAGTGGGTDRGETGRGGTGRGGTGGGGNGGTGNGGTGRGGTGGGGNGGTGNGGTD
FT                   GGTGRGGNGGNGGTGRGGNGGNGGTGRGGNGGTGNGETGRGGTGGAVGTTPGGTTGGAG
FT                   GGATGGSPMDGAAGGGSGAGGTGGGTDGGAGDGGSGDGGGAGGGSEVLSTTSTRRVVTA
FT                   DLDAADQALAKVGRKATVVLPDGTSIGGRVTDVGAVASAGDGDGGSGGEEAEDPTLPLT
FT                   IELDSARRLGQLDEAPVSVELAATTRKNVLAVPVAALIARPGGGYAVRVVGASGTTRDV
FT                   PVEPGMFADGWVELTGDSVRAGERVEVPR"
     MRRGDHADGS HVPGEVTRRR AAVGIALPLA ALAAVAAVVI ASSGGSGASG GSASASTTPM        60
     GTARVERRTL VEQKALDGTL GYDDPQPAVD RLGGTLTWLP RTGATIRPGQ RLFSVDGEPV       120
     VLMDGTVPAW RTLKEGIDDG EDVRQLEQNL AALGYDPGTV DDDFTSSTAD AVERWQDAWD       180
     LKETGEVELG RIVFLPGARR IAEVKGSLGG TGGSSGGGGD SVAWDGGSAA GGLRTMAVSD       240
     MSSGGAPVAA ATGTSTTPAP GATTPADPGN GTGGTGGTGG TGGDGGAGTG GGTDRGETGR       300
     GGTGRGGTGG GGNGGTGNGG TGRGGTGGGG NGGTGNGGTD GGTGRGGNGG NGGTGRGGNG       360
     GNGGTGRGGN GGTGNGETGR GGTGGAVGTT PGGTTGGAGG GATGGSPMDG AAGGGSGAGG       420
     TGGGTDGGAG DGGSGDGGGA GGGSEVLSTT STRRVVTADL DAADQALAKV GRKATVVLPD       480
     GTSIGGRVTD VGAVASAGDG DGGSGGEEAE DPTLPLTIEL DSARRLGQLD EAPVSVELAA       540
     TTRKNVLAVP VAALIARPGG GYAVRVVGAS GTTRDVPVEP GMFADGWVEL TGDSVRAGER       600
     VEVPR                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page