(data stored in ACNUC7421 zone)

EMBL: CP001854.PE226

CP001854.PE226       Location/Qualifiers
FT   CDS             complement(230112..230633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48662"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48662.1"
FT                   /translation="MPGITRPLLALLAAAFTVLTLAACGGDDKSDGSGSGSSEQEKALA
FT                   FQDCLRDRGLNATIDDRGRMMMRADAVRSGDAGDAAAPSMDGMPEAMEECRKSTGWEPP
FT                   APSEQERAEMQDRTLRFAQCMRAEGVDVPDPTGDGRMTMRIDGNREAFERAAKKCGGGI
FT                   TPMAPTSPAK"
     MPGITRPLLA LLAAAFTVLT LAACGGDDKS DGSGSGSSEQ EKALAFQDCL RDRGLNATID        60
     DRGRMMMRAD AVRSGDAGDA AAPSMDGMPE AMEECRKSTG WEPPAPSEQE RAEMQDRTLR       120
     FAQCMRAEGV DVPDPTGDGR MTMRIDGNRE AFERAAKKCG GGITPMAPTS PAK              173
//

If you have problems or comments...

PBIL Back to PBIL home page