(data stored in ACNUC7421 zone)

EMBL: CP001854.PE227

CP001854.PE227       Location/Qualifiers
FT   CDS             complement(230704..232152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0227"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   xcv:XCV0335 two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48663"
FT                   /db_xref="GOA:D3F5Z0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48663.1"
FT                   /translation="MSFRRRVVLLVAAAVATAILGASALVYVVMRSELYAQLDERLRAQ
FT                   APQAFFLPTSTERALGVQPPRGERRLKVLMRAPSDTITFPLPLSELSLYERARKTRGRI
FT                   VVPGPLGASTAVAQLVNVNGAVLGDDIGGPTLPTSDRTFAVAARQADAFFSDAEVDGVD
FT                   VRMLTVAGPDGSALTVAEPREDVDSALRRLLAILIGVSGTGVAAAAGLGVLVSRRALVP
FT                   VVHLTDATEHVAATQDLSRRIDVHGGDELARMATSFNTMLAALDGARAAQRQLVSDASH
FT                   ELRTPLTAVRTSIEALAGAPDLPAAERARVLDAARVQLEDLSVLVGDLVDLARPAAPAE
FT                   EVEDVRLDLLVGEAVERARRHAPDATFRLDASESLVRAAPGRLHRAVGNLLDNAVKHGG
FT                   ADGSVDVCVRGGEVRVRDHGPGIAPEDLPHVFDRFYRARRARGLPGAGLGLAIVRQVAE
FT                   AHGGSVRAESPDDGGARLVLSLPS"
     MSFRRRVVLL VAAAVATAIL GASALVYVVM RSELYAQLDE RLRAQAPQAF FLPTSTERAL        60
     GVQPPRGERR LKVLMRAPSD TITFPLPLSE LSLYERARKT RGRIVVPGPL GASTAVAQLV       120
     NVNGAVLGDD IGGPTLPTSD RTFAVAARQA DAFFSDAEVD GVDVRMLTVA GPDGSALTVA       180
     EPREDVDSAL RRLLAILIGV SGTGVAAAAG LGVLVSRRAL VPVVHLTDAT EHVAATQDLS       240
     RRIDVHGGDE LARMATSFNT MLAALDGARA AQRQLVSDAS HELRTPLTAV RTSIEALAGA       300
     PDLPAAERAR VLDAARVQLE DLSVLVGDLV DLARPAAPAE EVEDVRLDLL VGEAVERARR       360
     HAPDATFRLD ASESLVRAAP GRLHRAVGNL LDNAVKHGGA DGSVDVCVRG GEVRVRDHGP       420
     GIAPEDLPHV FDRFYRARRA RGLPGAGLGL AIVRQVAEAH GGSVRAESPD DGGARLVLSL       480
     PS                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page