(data stored in ACNUC7421 zone)

EMBL: CP001854.PE228

CP001854.PE228       Location/Qualifiers
FT   CDS             complement(232149..232820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0228"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gme:Gmet_3383 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48664"
FT                   /db_xref="GOA:D3F5Z1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48664.1"
FT                   /translation="MVVDDEPAMREALELALRLDGFEVELASDGRDAIRRLPGARPDVV
FT                   LLDVLMPELDGIEVCRRMRDAGDRTPVLMLTARDEVDDRVAGLEAGADDYLSKPFALPE
FT                   LLARLHALLRRTGWAADAELLRFEDLELDPAACEAKRGGQTLELTRTEFLLLELFLRNP
FT                   RQVLTRAVIVERVWGYDFGPTSNSIEVYVGYLRRKTEAAGASRLLHTVRGVGYVLRQAT
FT                   T"
     MVVDDEPAMR EALELALRLD GFEVELASDG RDAIRRLPGA RPDVVLLDVL MPELDGIEVC        60
     RRMRDAGDRT PVLMLTARDE VDDRVAGLEA GADDYLSKPF ALPELLARLH ALLRRTGWAA       120
     DAELLRFEDL ELDPAACEAK RGGQTLELTR TEFLLLELFL RNPRQVLTRA VIVERVWGYD       180
     FGPTSNSIEV YVGYLRRKTE AAGASRLLHT VRGVGYVLRQ ATT                         223
//

If you have problems or comments...

PBIL Back to PBIL home page