(data stored in ACNUC7421 zone)

EMBL: CP001854.PE229

CP001854.PE229       Location/Qualifiers
FT   CDS             complement(232886..233710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0229"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bxe:Bxe_B0860 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48665"
FT                   /db_xref="GOA:D3F5Z2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB48665.1"
FT                   /translation="MATIEIPHGTRSGVGPLLRGWRQRRRLSQLDLALEAGVSARHLSF
FT                   VETGRSKPSSEMVLHLAEQLDVPLRERNQLLLAAGYAPVFGERELDAPEMAPVHDAIQR
FT                   VLDGHDPYPAVVVDRTWNLVAANHSLALLTDGVSPELLRPPGNAMRLSLHPDGLAPRIV
FT                   NLGEWRDHLLARLARQVAATGDAKLSALLEEVAAYPAPDGVPEPPATAAGHDLAEQIAV
FT                   PLRLRHGDGELRFISIVATFGTAVDITVAELSIESFFPADEATAEAVRAHAG"
     MATIEIPHGT RSGVGPLLRG WRQRRRLSQL DLALEAGVSA RHLSFVETGR SKPSSEMVLH        60
     LAEQLDVPLR ERNQLLLAAG YAPVFGEREL DAPEMAPVHD AIQRVLDGHD PYPAVVVDRT       120
     WNLVAANHSL ALLTDGVSPE LLRPPGNAMR LSLHPDGLAP RIVNLGEWRD HLLARLARQV       180
     AATGDAKLSA LLEEVAAYPA PDGVPEPPAT AAGHDLAEQI AVPLRLRHGD GELRFISIVA       240
     TFGTAVDITV AELSIESFFP ADEATAEAVR AHAG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page