(data stored in ACNUC7421 zone)

EMBL: CP001854.PE23

CP001854.PE23        Location/Qualifiers
FT   CDS             complement(27180..27731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: har:HEAR1931 putative type I secretion
FT                   membrane fusion protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48459"
FT                   /db_xref="GOA:D3F3X6"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48459.1"
FT                   /translation="MSATALPHGGTGLPVDPLLTNDVVAHLDAQITSAARLLEIAMAQA
FT                   AAIAERDVDAVVRQITAFQAELERRTRIEDERARLLARAGAALRLSPAEVTITRITLLM
FT                   GPAEAQIAASRSAELQGLLSELSARHASNQALMRQELAFLDHLLNLIEPVTALGYEQGG
FT                   GRNTMPAAPLPGHHALDLHA"
     MSATALPHGG TGLPVDPLLT NDVVAHLDAQ ITSAARLLEI AMAQAAAIAE RDVDAVVRQI        60
     TAFQAELERR TRIEDERARL LARAGAALRL SPAEVTITRI TLLMGPAEAQ IAASRSAELQ       120
     GLLSELSARH ASNQALMRQE LAFLDHLLNL IEPVTALGYE QGGGRNTMPA APLPGHHALD       180
     LHA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page