(data stored in ACNUC7421 zone)

EMBL: CP001854.PE230

CP001854.PE230       Location/Qualifiers
FT   CDS             233806..234249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48666"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48666.1"
FT                   /translation="MEITDAPTAARQSRAGTQDEDAIRAVIADVETGFNTNDADLLSRH
FT                   FAGDAKVVAAFGQTIDGREAIDEANRQGVASPFLKDATAHYTVSSITFVEEDVALVRKL
FT                   AWSTAEDESAGKPPEMVALYVFVRRDGRWWIAARQNTLIGQPA"
     MEITDAPTAA RQSRAGTQDE DAIRAVIADV ETGFNTNDAD LLSRHFAGDA KVVAAFGQTI        60
     DGREAIDEAN RQGVASPFLK DATAHYTVSS ITFVEEDVAL VRKLAWSTAE DESAGKPPEM       120
     VALYVFVRRD GRWWIAARQN TLIGQPA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page