(data stored in ACNUC7421 zone)

EMBL: CP001854.PE231

CP001854.PE231       Location/Qualifiers
FT   CDS             complement(234277..234879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0231"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_4263
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48667"
FT                   /db_xref="GOA:D3F5Z4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48667.1"
FT                   /translation="MAAPPTRPALRRRYDAKRDGVVETAAELFAGRGYHATRMQDVTAA
FT                   TGLTAGGLYHYFGSKEQLLIAICDALMEPLLSKVEALGIDELEAQLALRALVAAWVAHV
FT                   AAHRQHMIVFLQERHVIEREPQWRHVAASRKRFERLLERTLERVEREGGVAFADRRLTT
FT                   FALLGMVNHLPQWYRPRGRLSVEQIADGFCDMVLPAA"
     MAAPPTRPAL RRRYDAKRDG VVETAAELFA GRGYHATRMQ DVTAATGLTA GGLYHYFGSK        60
     EQLLIAICDA LMEPLLSKVE ALGIDELEAQ LALRALVAAW VAHVAAHRQH MIVFLQERHV       120
     IEREPQWRHV AASRKRFERL LERTLERVER EGGVAFADRR LTTFALLGMV NHLPQWYRPR       180
     GRLSVEQIAD GFCDMVLPAA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page