(data stored in ACNUC7421 zone)

EMBL: CP001854.PE232

CP001854.PE232       Location/Qualifiers
FT   CDS             234950..236098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0232"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dal:Dalk_4346
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48668"
FT                   /db_xref="GOA:D3F5Z5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z5"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB48668.1"
FT                   /translation="MDFDLSDDHRLLRSTVRDFAEQEIAPVAEELDRTKAFPYDIVRRL
FT                   GELNLMGIPFPEEVGGAGADTLAYAIAVEELARIDSSVAITLCAHTSLGTQPIYLFGSE
FT                   EQKRDWLPRLTAGERLGAFGLTEPEAGSDAGNVQTRATLDNGEWVVNGAKQFITNAGTD
FT                   ISGCVVITAVTGTDDRGRKEISNILVPNGTPGYEQGTPYRKMGWNASDTRPLTFTDCRV
FT                   PEDQLVGPRGAGFKQFLRVLDIGRIGVAAMGVGLAQGALDEAVKYSKERKAFGQPISKF
FT                   QAIQGKLADVATELAAARLLTYNAAFLKDRGRDFSLTAAQAKLKTGRLAVRASEEAVQI
FT                   HGGYGYIEEYPVCRFYRDAKILTIGEGTDEVQQMVIARALGA"
     MDFDLSDDHR LLRSTVRDFA EQEIAPVAEE LDRTKAFPYD IVRRLGELNL MGIPFPEEVG        60
     GAGADTLAYA IAVEELARID SSVAITLCAH TSLGTQPIYL FGSEEQKRDW LPRLTAGERL       120
     GAFGLTEPEA GSDAGNVQTR ATLDNGEWVV NGAKQFITNA GTDISGCVVI TAVTGTDDRG       180
     RKEISNILVP NGTPGYEQGT PYRKMGWNAS DTRPLTFTDC RVPEDQLVGP RGAGFKQFLR       240
     VLDIGRIGVA AMGVGLAQGA LDEAVKYSKE RKAFGQPISK FQAIQGKLAD VATELAAARL       300
     LTYNAAFLKD RGRDFSLTAA QAKLKTGRLA VRASEEAVQI HGGYGYIEEY PVCRFYRDAK       360
     ILTIGEGTDE VQQMVIARAL GA                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page