(data stored in ACNUC7421 zone)

EMBL: CP001854.PE233

CP001854.PE233       Location/Qualifiers
FT   CDS             236098..237030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0233"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ade:Adeh_1644 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48669"
FT                   /db_xref="GOA:D3F5Z6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z6"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADB48669.1"
FT                   /translation="MGAVGLPARVHVREVGPRDGFQNEPETIATADKVALVNALARTGL
FT                   SRLEVTSFVRADVIPQLADAVELLGAIDVPDHVSVSVLVPNARGLDAALEVRDRFDEVN
FT                   VFLSASESHNRANVNRSVAESLDGIGRVAERARAAGLRCQGTISTAFGCPYEGRVPVER
FT                   ALEIARALHDLGCEEVGFGDTTGMANPVQVRAFFARATAELGEQVELTAHFHNTRGQGL
FT                   ANVLAALDAGCRSFESSFGELGGCPQSGPTHPATGNIASEDLVSMLHEMGVETGIDLAA
FT                   LIGASRAARDVLGRPLGSHVLTAGPVEWR"
     MGAVGLPARV HVREVGPRDG FQNEPETIAT ADKVALVNAL ARTGLSRLEV TSFVRADVIP        60
     QLADAVELLG AIDVPDHVSV SVLVPNARGL DAALEVRDRF DEVNVFLSAS ESHNRANVNR       120
     SVAESLDGIG RVAERARAAG LRCQGTISTA FGCPYEGRVP VERALEIARA LHDLGCEEVG       180
     FGDTTGMANP VQVRAFFARA TAELGEQVEL TAHFHNTRGQ GLANVLAALD AGCRSFESSF       240
     GELGGCPQSG PTHPATGNIA SEDLVSMLHE MGVETGIDLA ALIGASRAAR DVLGRPLGSH       300
     VLTAGPVEWR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page