(data stored in ACNUC7421 zone)

EMBL: CP001854.PE234

CP001854.PE234       Location/Qualifiers
FT   CDS             237021..239096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0234"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: reu:Reut_B4460 carbamoyl-phosphate synthase subunit
FT                   L"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48670"
FT                   /db_xref="GOA:D3F5Z7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z7"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADB48670.1"
FT                   /translation="MALIDTLSPVLIANRGEIAVRIERTLRRLGLGSVAVYSDADAGAP
FT                   HVLAADTAVRIGPADARSSYLSIPALLDAARVTGARAVHPGYGFLAESAPFAQAVIDAG
FT                   LTWIGPPPPAIELMGDKARAKQLAREAGVPVVPGIDGADLTYEQIDAFAAEHGFPVVVK
FT                   AVAGGGGKGMRVVRAATELRGALDAARREAAAAFGDDRVLVERYLERPRHIEVQVLADA
FT                   HGAVVHLGERECSLQRRHQKVVEEAPSPVVDPDWRAEMGAAAVRLAQACGYAGAGTVEL
FT                   IVPGGSGDVLSGEFFFLEMNTRLQVEHPVTELVYGVDLVEQQLRVAAGEPLALTQDELR
FT                   PRGHAVEARLYAEDPAAGFLPSTGVVRRWRAPAGTGVRSDDALADGVAVQTHYDPMLAK
FT                   LIAHGPDRATALARLDRALAELELLGVTTNAAFTRGLLAREDVRAGQMDTGLLERVLAG
FT                   GEEGGASPAAGTAASGPAAAGAAASGRVAGLAPLDDLLPAAALTLALADADALGAHTSV
FT                   PLGWRSDGAAGTWRRRVVPGGGDAVELCVRGETVTVGERTWCGRATRSGEHAVEVELDG
FT                   VARRYAIATGDGDGRLWIGRAGQQLELAPARAGGADLSAAGDSLAAPMPGTILLVHVSD
FT                   GDAVREGDVLVVMESMKMELSVTAPHDGTVDGLTVKAGDRVALREVLLAVHGEDAA"
     MALIDTLSPV LIANRGEIAV RIERTLRRLG LGSVAVYSDA DAGAPHVLAA DTAVRIGPAD        60
     ARSSYLSIPA LLDAARVTGA RAVHPGYGFL AESAPFAQAV IDAGLTWIGP PPPAIELMGD       120
     KARAKQLARE AGVPVVPGID GADLTYEQID AFAAEHGFPV VVKAVAGGGG KGMRVVRAAT       180
     ELRGALDAAR REAAAAFGDD RVLVERYLER PRHIEVQVLA DAHGAVVHLG ERECSLQRRH       240
     QKVVEEAPSP VVDPDWRAEM GAAAVRLAQA CGYAGAGTVE LIVPGGSGDV LSGEFFFLEM       300
     NTRLQVEHPV TELVYGVDLV EQQLRVAAGE PLALTQDELR PRGHAVEARL YAEDPAAGFL       360
     PSTGVVRRWR APAGTGVRSD DALADGVAVQ THYDPMLAKL IAHGPDRATA LARLDRALAE       420
     LELLGVTTNA AFTRGLLARE DVRAGQMDTG LLERVLAGGE EGGASPAAGT AASGPAAAGA       480
     AASGRVAGLA PLDDLLPAAA LTLALADADA LGAHTSVPLG WRSDGAAGTW RRRVVPGGGD       540
     AVELCVRGET VTVGERTWCG RATRSGEHAV EVELDGVARR YAIATGDGDG RLWIGRAGQQ       600
     LELAPARAGG ADLSAAGDSL AAPMPGTILL VHVSDGDAVR EGDVLVVMES MKMELSVTAP       660
     HDGTVDGLTV KAGDRVALRE VLLAVHGEDA A                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page