(data stored in ACNUC7421 zone)

EMBL: CP001854.PE235

CP001854.PE235       Location/Qualifiers
FT   CDS             239093..240616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0235"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: carboxyl transferase; KEGG: atc:AGR_L_2706
FT                   3-methylcrotonyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48671"
FT                   /db_xref="GOA:D3F5Z8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z8"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADB48671.1"
FT                   /translation="MSFRDGHLELIADLEARLERVRGGGGAKATERHVARGKLPARERV
FT                   ERLCDPGAPFLELAPLAAEEMYDGAAPGAGVVAGVGIVHGRHCMIVANDATVKGGTYFP
FT                   ITVKKHLRAQEIAAENRLPCIYLVDSGGAFLPMQDEVFPDREHFGRIFFNQANMSKRGI
FT                   PQLSAVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAATGEEVTAEELGGGDV
FT                   HARTSGVVDHLAEDDADALQRIRDAVATLPAPQAPPWERIAARPPAHAEDPDGLLDVVP
FT                   LDTRTPYDVRDALRRIVDGGELHEFKALYGTTLVCAFAHVDGHPVGIVANNGVLFSESS
FT                   LKGAHFVELCDRRGIPLLFVQNVAGFMVGRDYEAGGIAKDGAKLVTAVSCARVPKLTVI
FT                   AGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAGAVMTEVGQPEVGAQLREQYE
FT                   HQGRPIYATARLWDDGVIDPRQTRNVLAAALAACANAPLEPVGYGVFRM"
     MSFRDGHLEL IADLEARLER VRGGGGAKAT ERHVARGKLP ARERVERLCD PGAPFLELAP        60
     LAAEEMYDGA APGAGVVAGV GIVHGRHCMI VANDATVKGG TYFPITVKKH LRAQEIAAEN       120
     RLPCIYLVDS GGAFLPMQDE VFPDREHFGR IFFNQANMSK RGIPQLSAVM GSCTAGGAYV       180
     PAMSDETVIV REQGTIFLGG PPLVKAATGE EVTAEELGGG DVHARTSGVV DHLAEDDADA       240
     LQRIRDAVAT LPAPQAPPWE RIAARPPAHA EDPDGLLDVV PLDTRTPYDV RDALRRIVDG       300
     GELHEFKALY GTTLVCAFAH VDGHPVGIVA NNGVLFSESS LKGAHFVELC DRRGIPLLFV       360
     QNVAGFMVGR DYEAGGIAKD GAKLVTAVSC ARVPKLTVIA GGSFGAGNYG MCGRAYSPRF       420
     LWMWPNARIS VMGGEQAGAV MTEVGQPEVG AQLREQYEHQ GRPIYATARL WDDGVIDPRQ       480
     TRNVLAAALA ACANAPLEPV GYGVFRM                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page