(data stored in ACNUC7421 zone)

EMBL: CP001854.PE236

CP001854.PE236       Location/Qualifiers
FT   CDS             240671..241879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48672"
FT                   /db_xref="UniProtKB/TrEMBL:D3F5Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48672.1"
FT                   /translation="MRHLSAFLVIVACAVPSGLAAPAQAEEPVPALAPETVPAAVTAAV
FT                   NALALDARPCELMTRDLREHVAVVELLSHDPVVAEPWEPTDVTRLCNAYVVAGVGFGVG
FT                   IFPDRGGWVATEIGPARVVETSGDMVRLRSRVVQRFTPARDVLGSERVVDLFVVREEGV
FT                   WRLASLAGLLQLDLSNGSVPGTLAAFARERRAQTAETRRRLRAHARMVRELASVPRPLS
FT                   RTSPSCGAGGRGGVSGRADSSSNVRRFDEHSERVRGPRAARADMVAVRLRTWGGRMCWT
FT                   VRFRGDVADRIDVRFILTQPSGRDDLRAASWSLRLDGGRAAGVLEDHDGVQRMFAVRAS
FT                   VRGRVLRVVVPARRVRGQVRTGERFRWSAIDYMPDPDRPPGGTVEWVDELPQLVERGIL
FT                   HRP"
     MRHLSAFLVI VACAVPSGLA APAQAEEPVP ALAPETVPAA VTAAVNALAL DARPCELMTR        60
     DLREHVAVVE LLSHDPVVAE PWEPTDVTRL CNAYVVAGVG FGVGIFPDRG GWVATEIGPA       120
     RVVETSGDMV RLRSRVVQRF TPARDVLGSE RVVDLFVVRE EGVWRLASLA GLLQLDLSNG       180
     SVPGTLAAFA RERRAQTAET RRRLRAHARM VRELASVPRP LSRTSPSCGA GGRGGVSGRA       240
     DSSSNVRRFD EHSERVRGPR AARADMVAVR LRTWGGRMCW TVRFRGDVAD RIDVRFILTQ       300
     PSGRDDLRAA SWSLRLDGGR AAGVLEDHDG VQRMFAVRAS VRGRVLRVVV PARRVRGQVR       360
     TGERFRWSAI DYMPDPDRPP GGTVEWVDEL PQLVERGILH RP                          402
//

If you have problems or comments...

PBIL Back to PBIL home page