(data stored in ACNUC7421 zone)

EMBL: CP001854.PE237

CP001854.PE237       Location/Qualifiers
FT   CDS             242100..243434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0237"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bam:Bamb_4932 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48673"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3F600"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB48673.1"
FT                   /translation="MRWMLRAVVATVLLVAAAFTVTACGSSDDSSESASTTTGGGRGGA
FT                   KITVWHNSADPPALRQLYKDFEADTGNEVELVAIPSAGFEDTTLTKWASGARPDVLEYH
FT                   PTVTNLLALNPRNTLRDLSGEEYIAKSGDLYRSAATVDGTTYGAIIGFPQVFGMFYNKD
FT                   VFARAGIATPPGNAQELAQACTDIKARAPGVTPIAESGGSVWPPQVLPSLLMGDANQDN
FT                   AWGQELRSNRAALDDDGSPFVRAMETYRQLKDDGCFNRDLVTATVENSVRALVEGRAAM
FT                   VALHSDMIPAIVAAAGGDAARVDRAIGFLVLGGESAAATYIPGPIGSYYLPRTGDGDRE
FT                   AAALDFVRYATGRGYGRYIEASRTFPIIEGTPEPSGISALQREVKAAYDRGPANIAYAA
FT                   DVPGVAGVAALINKLMIDETTPQEMAEQTQKQIEQAAKAAKLEGW"
     MRWMLRAVVA TVLLVAAAFT VTACGSSDDS SESASTTTGG GRGGAKITVW HNSADPPALR        60
     QLYKDFEADT GNEVELVAIP SAGFEDTTLT KWASGARPDV LEYHPTVTNL LALNPRNTLR       120
     DLSGEEYIAK SGDLYRSAAT VDGTTYGAII GFPQVFGMFY NKDVFARAGI ATPPGNAQEL       180
     AQACTDIKAR APGVTPIAES GGSVWPPQVL PSLLMGDANQ DNAWGQELRS NRAALDDDGS       240
     PFVRAMETYR QLKDDGCFNR DLVTATVENS VRALVEGRAA MVALHSDMIP AIVAAAGGDA       300
     ARVDRAIGFL VLGGESAAAT YIPGPIGSYY LPRTGDGDRE AAALDFVRYA TGRGYGRYIE       360
     ASRTFPIIEG TPEPSGISAL QREVKAAYDR GPANIAYAAD VPGVAGVAAL INKLMIDETT       420
     PQEMAEQTQK QIEQAAKAAK LEGW                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page