(data stored in ACNUC7421 zone)

EMBL: CP001854.PE238

CP001854.PE238       Location/Qualifiers
FT   CDS             243452..244441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0238"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_4466 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48674"
FT                   /db_xref="GOA:D3F601"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F601"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48674.1"
FT                   /translation="MASTALTQQATGPEQETPGRPPTPPGGGRRRRGARRGGSAPLRDA
FT                   AHRKWFALPAVVLVAVFFAAPFLLNAGFAFSDWSGYSDEIGFNGIDNFRTLIDQEIFWP
FT                   AVRTTLLYALLVLTFQMAVSLPLALALTETNRANSFFRSLFFLPVLISPLAAGYIWKGL
FT                   LAPNGPINGFLTFFLPGTVDHSWLGDPQTALPAVALIEAWKWSGLITLVYIAGLKAIPK
FT                   ELLEAATIDGANAWKRFWKVKLRLLAPALTFNVAVTLAVALMAYDVIAPTTNGGPGDHT
FT                   TTLNIAMRLQWGQSFFGPASALSLTVAVLVVLTAVPLVMWLRRKELDG"
     MASTALTQQA TGPEQETPGR PPTPPGGGRR RRGARRGGSA PLRDAAHRKW FALPAVVLVA        60
     VFFAAPFLLN AGFAFSDWSG YSDEIGFNGI DNFRTLIDQE IFWPAVRTTL LYALLVLTFQ       120
     MAVSLPLALA LTETNRANSF FRSLFFLPVL ISPLAAGYIW KGLLAPNGPI NGFLTFFLPG       180
     TVDHSWLGDP QTALPAVALI EAWKWSGLIT LVYIAGLKAI PKELLEAATI DGANAWKRFW       240
     KVKLRLLAPA LTFNVAVTLA VALMAYDVIA PTTNGGPGDH TTTLNIAMRL QWGQSFFGPA       300
     SALSLTVAVL VVLTAVPLVM WLRRKELDG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page