(data stored in ACNUC7421 zone)

EMBL: CP001854.PE239

CP001854.PE239       Location/Qualifiers
FT   CDS             244438..245271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0239"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_5606
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48675"
FT                   /db_xref="GOA:D3F602"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F602"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48675.1"
FT                   /translation="MTPRRATTIARYVALSLFAIPWVVLPLWMVVVNAFKTQGEAQALS
FT                   LDLPGEWAIGENFRTVIDDGNYLTGLLNSVLVTVPAIAVVLLLGSAAAWAFARTRSRWL
FT                   RAAYYLTTLSVLLPPAIIPSIYLLRELSLDGSRLGYALVTISARLGIVIFLTTGFVRAL
FT                   PGELEDAAAVDGASAFQTYRRILLPLMKPVLLVGGVILMITVWNDFFFALFLIQGEGSA
FT                   TLPLTLYGFASSTVDTLRWNLVFAHVVLTSLPLVVVYLFVQRRVLSGLTEGAVKG"
     MTPRRATTIA RYVALSLFAI PWVVLPLWMV VVNAFKTQGE AQALSLDLPG EWAIGENFRT        60
     VIDDGNYLTG LLNSVLVTVP AIAVVLLLGS AAAWAFARTR SRWLRAAYYL TTLSVLLPPA       120
     IIPSIYLLRE LSLDGSRLGY ALVTISARLG IVIFLTTGFV RALPGELEDA AAVDGASAFQ       180
     TYRRILLPLM KPVLLVGGVI LMITVWNDFF FALFLIQGEG SATLPLTLYG FASSTVDTLR       240
     WNLVFAHVVL TSLPLVVVYL FVQRRVLSGL TEGAVKG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page