(data stored in ACNUC7421 zone)

EMBL: CP001854.PE24

CP001854.PE24        Location/Qualifiers
FT   CDS             complement(27728..28024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48460"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48460.1"
FT                   /translation="MSIGGLPPVDAAQLPADIRDAPPVRRDTYSAALGFEQMLVQQLTT
FT                   QMAESARSAMGGDSPYASMLPQTLADGVMDAGGLGLARQMTDAIAPAKKETTT"
     MSIGGLPPVD AAQLPADIRD APPVRRDTYS AALGFEQMLV QQLTTQMAES ARSAMGGDSP        60
     YASMLPQTLA DGVMDAGGLG LARQMTDAIA PAKKETTT                                98
//

If you have problems or comments...

PBIL Back to PBIL home page