(data stored in ACNUC7421 zone)

EMBL: CP001854.PE240

CP001854.PE240       Location/Qualifiers
FT   CDS             245268..246314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0240"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: glo:Glov_2487
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48676"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3F603"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB48676.1"
FT                   /translation="MTTPSGDFDLVLDLIRGEVDSGRLPTAVFGVATSSGVQVLEAFGS
FT                   HGRRPLATDDTFLLFSASKPLIGLAALRLVEQGKLALRTALSEALPQFGMARIGDEVTL
FT                   WHLLTHTAGIVEATVTPDTPVREQLLTAPQMFRAGEYALYCNVAFEGIAALVESVTGRP
FT                   LHEHLPADLNALPGVEGLTFDPAAEVVPLAGLDRVLFDVERFRALRHPAGSLCARAEDL
FT                   LSLGSMLLRGDRELIHPTTLSASLTPQTTGIPRLLPDPLHIGPGTGQEWGLVWNMRMGS
FT                   PTLLEQRLYGHGGLSGCQWWMYPDHDACFVLLTGLMNPLDVGVDLDNVHNAFTTCLDPV
FT                   GASLGAAA"
     MTTPSGDFDL VLDLIRGEVD SGRLPTAVFG VATSSGVQVL EAFGSHGRRP LATDDTFLLF        60
     SASKPLIGLA ALRLVEQGKL ALRTALSEAL PQFGMARIGD EVTLWHLLTH TAGIVEATVT       120
     PDTPVREQLL TAPQMFRAGE YALYCNVAFE GIAALVESVT GRPLHEHLPA DLNALPGVEG       180
     LTFDPAAEVV PLAGLDRVLF DVERFRALRH PAGSLCARAE DLLSLGSMLL RGDRELIHPT       240
     TLSASLTPQT TGIPRLLPDP LHIGPGTGQE WGLVWNMRMG SPTLLEQRLY GHGGLSGCQW       300
     WMYPDHDACF VLLTGLMNPL DVGVDLDNVH NAFTTCLDPV GASLGAAA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page