(data stored in ACNUC7421 zone)

EMBL: CP001854.PE241

CP001854.PE241       Location/Qualifiers
FT   CDS             246311..247948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0241"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_1573 AMP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48677"
FT                   /db_xref="GOA:D3F604"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3F604"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB48677.1"
FT                   /translation="MSAPSYAHGVGDVALIGETIGENLAHTAARVPERDALVSCEQGIR
FT                   WTYAQLDAAVDRLATGLLRSGVAKGDRVGLWSPNRAEWTLVQYATARIGAVLVNVNPAY
FT                   RTHELSYALRHSGTKLLFSARAFKTSDYAAMVAQVGDELQELERVVFFDDDPAWDELAA
FT                   TPADAAALAERAATLSFDDPIDIQYTSGTTGAPKGATLSHHNLLNNGFLVGELIHYSEH
FT                   DRICLPVPFYHCFGMVMGNLAATSHGACMVIPSAGFDPLATLRAVAQERCTSLYGVPTM
FT                   FIAELEHPSFAEHDLSSLRTGIMAGSPCPIEVMKQVIDKMHMREVSICYGMTETSPVST
FT                   QTRTDDPLELRVGSVGRVGPHVEVKVVEPDTGMIVKRGETGELRTRGYSVMLGYWGELE
FT                   KTAEAIDAAGWMHTGDLATMDDAGYVAIVGRIKDMVIRGGENVYPRELEELLHLHDDVV
FT                   DVQVVGVPDAKYGEELCAWVRLRDGAAVGEDDVRAFCRERVAHFKVPRHVLFVDEFPMT
FT                   VTGKVQKYKMREATIERLGLDTMEVEGR"
     MSAPSYAHGV GDVALIGETI GENLAHTAAR VPERDALVSC EQGIRWTYAQ LDAAVDRLAT        60
     GLLRSGVAKG DRVGLWSPNR AEWTLVQYAT ARIGAVLVNV NPAYRTHELS YALRHSGTKL       120
     LFSARAFKTS DYAAMVAQVG DELQELERVV FFDDDPAWDE LAATPADAAA LAERAATLSF       180
     DDPIDIQYTS GTTGAPKGAT LSHHNLLNNG FLVGELIHYS EHDRICLPVP FYHCFGMVMG       240
     NLAATSHGAC MVIPSAGFDP LATLRAVAQE RCTSLYGVPT MFIAELEHPS FAEHDLSSLR       300
     TGIMAGSPCP IEVMKQVIDK MHMREVSICY GMTETSPVST QTRTDDPLEL RVGSVGRVGP       360
     HVEVKVVEPD TGMIVKRGET GELRTRGYSV MLGYWGELEK TAEAIDAAGW MHTGDLATMD       420
     DAGYVAIVGR IKDMVIRGGE NVYPRELEEL LHLHDDVVDV QVVGVPDAKY GEELCAWVRL       480
     RDGAAVGEDD VRAFCRERVA HFKVPRHVLF VDEFPMTVTG KVQKYKMREA TIERLGLDTM       540
     EVEGR                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page