(data stored in ACNUC7421 zone)

EMBL: CP001854.PE242

CP001854.PE242       Location/Qualifiers
FT   CDS             247945..248733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0242"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: smt:Smal_3818 DNA-binding
FT                   transcriptional regulator AgaR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48678"
FT                   /db_xref="GOA:D3F605"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3F605"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADB48678.1"
FT                   /translation="MTSGMYRRFVPAERRRRMAALLQRRGSVSIAELEEAFGISAMTAR
FT                   RDLAALEERGLVTRTWGGASTLAPVAHEASFADRVRRDPERKRRLADEAYKLVQPNETL
FT                   LVDSSSTGWYFVERLLEEPLPCTVITNSLAIVDLAAEVPAQVQVVVIGGILRPLTRSTV
FT                   GPAATKAIRGYYADRAIVSVYGVGTDGGLTDPDAYESEVKAAIVARAREPMLLVDASKF
FT                   GTLAQNRIGAADEFSHAIVADVGRDATDMLVGAGVELHEA"
     MTSGMYRRFV PAERRRRMAA LLQRRGSVSI AELEEAFGIS AMTARRDLAA LEERGLVTRT        60
     WGGASTLAPV AHEASFADRV RRDPERKRRL ADEAYKLVQP NETLLVDSSS TGWYFVERLL       120
     EEPLPCTVIT NSLAIVDLAA EVPAQVQVVV IGGILRPLTR STVGPAATKA IRGYYADRAI       180
     VSVYGVGTDG GLTDPDAYES EVKAAIVARA REPMLLVDAS KFGTLAQNRI GAADEFSHAI       240
     VADVGRDATD MLVGAGVELH EA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page