(data stored in ACNUC7421 zone)

EMBL: CP001854.PE243

CP001854.PE243       Location/Qualifiers
FT   CDS             248737..251652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0243"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: alfa-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48679"
FT                   /db_xref="GOA:D3F606"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:D3F606"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ADB48679.1"
FT                   /translation="MAAYEGNQRVGELRGERLRCERLSDPLAVEPARPRLSWIAAAAAA
FT                   PGTSGPASGAGASGAAAGEPADAAVSRGQRPTAYRVLAASSLKALSAVSERLAGGGERR
FT                   GGAHRLPAGGRDLLWDSGRVAAAETLAVEWGGAPLAPCVRVFWRVLVWDRDGRVGPPSA
FT                   IATFGAGLGDGEDAWGGAQWLGHGHPWAEHTPAGGDELDPLHNMGMTSALLRTEFALTR
FT                   PVVRATAYATARGVYRLRLNGARVGDDELAPGWTDYRRRIHYQAFDLTRRLRSGANALG
FT                   VELGEGWYAGYVGWMAKHAGGHYGARPSALVHVRVEHADGSLTLLSTDGGGWRATRGPR
FT                   VYSDLQMGERFDARLVEAGWDEPGFDDAGWEQAVVHAPPAGARLEAQPCEPARALRELA
FT                   PIALTEPRPGTWVFDLGQNLVGWARLRAAGPRGTAVTLRFGELLRPDGTLYTDNLRTAA
FT                   ARDTFVLAGRDDGTPEQFEPAFTFHGFRYVELTGLPTAPALADLTACVVHSDAPWAGEF
FT                   ACSHELLNAIARNAEWGQRGNFLSIPTDCPQRDERLGWLADTQVFAATALRNMDCTAFL
FT                   SKWLQDVRDAQADDGAFPDVAPLPPAYDVLSHGAPGWGDGGVIVPWLVWRASGERAVLA
FT                   AHYPAMVRWMEHLAALNPSHLRRDGLYNSYGDWLNVDAQTPKDLLATAYWALDARLLEQ
FT                   IARELGHEPDATRWRALHARVAAAFGAEWVAADGSLRTPTQTGYLLALHAELLPPALRA
FT                   SAAAHLAADVVARGRRLSTGFIGTGLLCPLLTEHGHAELAYDLALADTHPSWGATVRAG
FT                   ATTMWERWDGWSEDGGFASPNMNSFNHYAFGAIGEWLHRHVAGLDQHPDVPGWGHVWVR
FT                   PQLDARLTWARAAHDSPRGPVRAGWELRDGELTLDVEIPPGAVGTVFVPGGDAAALRES
FT                   GRPLADVAGVRLDGIEGDRIVVHVDSGRYVFTHQEGRDGDD"
     MAAYEGNQRV GELRGERLRC ERLSDPLAVE PARPRLSWIA AAAAAPGTSG PASGAGASGA        60
     AAGEPADAAV SRGQRPTAYR VLAASSLKAL SAVSERLAGG GERRGGAHRL PAGGRDLLWD       120
     SGRVAAAETL AVEWGGAPLA PCVRVFWRVL VWDRDGRVGP PSAIATFGAG LGDGEDAWGG       180
     AQWLGHGHPW AEHTPAGGDE LDPLHNMGMT SALLRTEFAL TRPVVRATAY ATARGVYRLR       240
     LNGARVGDDE LAPGWTDYRR RIHYQAFDLT RRLRSGANAL GVELGEGWYA GYVGWMAKHA       300
     GGHYGARPSA LVHVRVEHAD GSLTLLSTDG GGWRATRGPR VYSDLQMGER FDARLVEAGW       360
     DEPGFDDAGW EQAVVHAPPA GARLEAQPCE PARALRELAP IALTEPRPGT WVFDLGQNLV       420
     GWARLRAAGP RGTAVTLRFG ELLRPDGTLY TDNLRTAAAR DTFVLAGRDD GTPEQFEPAF       480
     TFHGFRYVEL TGLPTAPALA DLTACVVHSD APWAGEFACS HELLNAIARN AEWGQRGNFL       540
     SIPTDCPQRD ERLGWLADTQ VFAATALRNM DCTAFLSKWL QDVRDAQADD GAFPDVAPLP       600
     PAYDVLSHGA PGWGDGGVIV PWLVWRASGE RAVLAAHYPA MVRWMEHLAA LNPSHLRRDG       660
     LYNSYGDWLN VDAQTPKDLL ATAYWALDAR LLEQIARELG HEPDATRWRA LHARVAAAFG       720
     AEWVAADGSL RTPTQTGYLL ALHAELLPPA LRASAAAHLA ADVVARGRRL STGFIGTGLL       780
     CPLLTEHGHA ELAYDLALAD THPSWGATVR AGATTMWERW DGWSEDGGFA SPNMNSFNHY       840
     AFGAIGEWLH RHVAGLDQHP DVPGWGHVWV RPQLDARLTW ARAAHDSPRG PVRAGWELRD       900
     GELTLDVEIP PGAVGTVFVP GGDAAALRES GRPLADVAGV RLDGIEGDRI VVHVDSGRYV       960
     FTHQEGRDGD D                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page