(data stored in ACNUC7421 zone)

EMBL: CP001854.PE244

CP001854.PE244       Location/Qualifiers
FT   CDS             251639..252745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: noc:Noc_0279
FT                   ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48680"
FT                   /db_xref="GOA:D3F607"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F607"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48680.1"
FT                   /translation="MATIELHGVTKRYPDGTEAVRAIDLDVADGEFLILVGPSGCGKTT
FT                   ALRMIAGLESITDGELRIDGERVNERAPKDRDIAMVFQSYALYPHMSVRDNMGFALQLA
FT                   KTPKAEVAARVEEAARVLDLTGHLDRKPGQLSGGQRQRVAMGRAIVRQPKAFLMDEPLS
FT                   NLDAKLRVQMRAELARLQHRLGTTTVYVTHDQVEAMTLGDRVAVMRDGVIQQLDTPAAL
FT                   YERPANLFVAGFIGAPGMNVVEASVADGVLRLPFGDVALPGDGDVPAGDVVAGIRPEQF
FT                   EAAALARGADPGHPRFRIVPDLVESVGSDLYAYFDLDGRQLVARLDVESRARVGEAVEL
FT                   VLDPSRIQLFNPADGRNLAVTPLTTAAR"
     MATIELHGVT KRYPDGTEAV RAIDLDVADG EFLILVGPSG CGKTTALRMI AGLESITDGE        60
     LRIDGERVNE RAPKDRDIAM VFQSYALYPH MSVRDNMGFA LQLAKTPKAE VAARVEEAAR       120
     VLDLTGHLDR KPGQLSGGQR QRVAMGRAIV RQPKAFLMDE PLSNLDAKLR VQMRAELARL       180
     QHRLGTTTVY VTHDQVEAMT LGDRVAVMRD GVIQQLDTPA ALYERPANLF VAGFIGAPGM       240
     NVVEASVADG VLRLPFGDVA LPGDGDVPAG DVVAGIRPEQ FEAAALARGA DPGHPRFRIV       300
     PDLVESVGSD LYAYFDLDGR QLVARLDVES RARVGEAVEL VLDPSRIQLF NPADGRNLAV       360
     TPLTTAAR                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page