(data stored in ACNUC7421 zone)

EMBL: CP001854.PE245

CP001854.PE245       Location/Qualifiers
FT   CDS             252799..254385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48681"
FT                   /db_xref="UniProtKB/TrEMBL:D3F608"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48681.1"
FT                   /translation="MGRMRRMGLPLLALAAGLALPSSALADEIACPARVDASAFATEAK
FT                   LLQLAERQQSFGVRPTGSQSQKDYIDWLEAEMSAIPGIRTSSLNYDIDRYESVTTGLTA
FT                   GGASVPVAAPVPFARSTGAAGVTAPVVYLASGTNITAANAAGKIVVRDLPTLSVPNALF
FT                   FPPLLGWAVHDPGLTIPLLGSESLEAPAQSNADIAAASAAGAVGVLMVSQLPHAQVEGM
FT                   YAPYEGLPQALPAAYLGVDQGQQLKDALAARTLASATLTVDARWTPTTTRTLLATLPGG
FT                   EAKKIVVESHTDGTSALWDNGPLSMIEMARYLATLPVECRPRTIQFAFTTGHLYQHLTG
FT                   PDVREGGAGQLAAILDREYDEGKVAGVLVVEHLGARQYDAVARPGGLPGRQLVVNRSLS
FT                   QLLWLPVTDGWPLRDMVKAAIQDRDVRRTAMLTGLDGADVTRVPHHCSFGGEGTPYVQH
FT                   LLPTIAAIAAPKTLFLASFGTEAIDFGLMRRGTLAFTDMVMRMGTMSQADIAGDMTFMR
FT                   EQRARGARGCS"
     MGRMRRMGLP LLALAAGLAL PSSALADEIA CPARVDASAF ATEAKLLQLA ERQQSFGVRP        60
     TGSQSQKDYI DWLEAEMSAI PGIRTSSLNY DIDRYESVTT GLTAGGASVP VAAPVPFARS       120
     TGAAGVTAPV VYLASGTNIT AANAAGKIVV RDLPTLSVPN ALFFPPLLGW AVHDPGLTIP       180
     LLGSESLEAP AQSNADIAAA SAAGAVGVLM VSQLPHAQVE GMYAPYEGLP QALPAAYLGV       240
     DQGQQLKDAL AARTLASATL TVDARWTPTT TRTLLATLPG GEAKKIVVES HTDGTSALWD       300
     NGPLSMIEMA RYLATLPVEC RPRTIQFAFT TGHLYQHLTG PDVREGGAGQ LAAILDREYD       360
     EGKVAGVLVV EHLGARQYDA VARPGGLPGR QLVVNRSLSQ LLWLPVTDGW PLRDMVKAAI       420
     QDRDVRRTAM LTGLDGADVT RVPHHCSFGG EGTPYVQHLL PTIAAIAAPK TLFLASFGTE       480
     AIDFGLMRRG TLAFTDMVMR MGTMSQADIA GDMTFMREQR ARGARGCS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page