(data stored in ACNUC7421 zone)

EMBL: CP001854.PE246

CP001854.PE246       Location/Qualifiers
FT   CDS             254376..256328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48682"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D3F609"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48682.1"
FT                   /translation="MLLSTYVAGAAAAALALGVGAVGAATATAADPPPFIPIERQTIPL
FT                   PEGYAASTPIWTQDGGTAGEAGGHLLFSSGGQLHTIGEDGRGLQCISCGLSNDPRIVPA
FT                   AQEAFKDVFPDGRRVMWGDFERAFVLECSPSVLQCDDRALLPVDVSGERGTGLPGLFDP
FT                   LVLGSGVWHLAPDGEHIGWTASRLDTRPMLVARLERRTDRYVATNIKTVNPPGPRNGLD
FT                   SDPRGWTNGGALYELKGFADGGASVTYVTSQYEGNPDLYKTNLATGEMTRLTGHPDWDE
FT                   DSGDSPDGELTMLHSDRGMHRVDAAGLLPRRSFVDYPISVNAAIYYVGHEEGFQCDLQP
FT                   WLLPASGDGAGRLLGQPLAPYEGGDLHPQNNVPGRGAWNPTSTKVALTEMSYTTGLGPN
FT                   RLLVAKLKRAATRPQPVVSSAVGAWARRPGDYKGTIDSNALLVTVHGLHSGRAFLSHAG
FT                   TIVAGTFSVTYDRYSDDGETFVSGTERIVAPALAQAPAVNTADLVLTGTRTGYMRANYT
FT                   IGRLLGRPVASGGVDAMLDGYRLSGDIPRLGACPDKLPRTAPLELSASVAPGAGGTRVV
FT                   TAQVHADSDPDGYAAGSFGDRRPVAGAVVTVAGQQVDTDQDGRATVVVPAGPSGPLEVG
FT                   ASAGDTFTPTRVEVS"
     MLLSTYVAGA AAAALALGVG AVGAATATAA DPPPFIPIER QTIPLPEGYA ASTPIWTQDG        60
     GTAGEAGGHL LFSSGGQLHT IGEDGRGLQC ISCGLSNDPR IVPAAQEAFK DVFPDGRRVM       120
     WGDFERAFVL ECSPSVLQCD DRALLPVDVS GERGTGLPGL FDPLVLGSGV WHLAPDGEHI       180
     GWTASRLDTR PMLVARLERR TDRYVATNIK TVNPPGPRNG LDSDPRGWTN GGALYELKGF       240
     ADGGASVTYV TSQYEGNPDL YKTNLATGEM TRLTGHPDWD EDSGDSPDGE LTMLHSDRGM       300
     HRVDAAGLLP RRSFVDYPIS VNAAIYYVGH EEGFQCDLQP WLLPASGDGA GRLLGQPLAP       360
     YEGGDLHPQN NVPGRGAWNP TSTKVALTEM SYTTGLGPNR LLVAKLKRAA TRPQPVVSSA       420
     VGAWARRPGD YKGTIDSNAL LVTVHGLHSG RAFLSHAGTI VAGTFSVTYD RYSDDGETFV       480
     SGTERIVAPA LAQAPAVNTA DLVLTGTRTG YMRANYTIGR LLGRPVASGG VDAMLDGYRL       540
     SGDIPRLGAC PDKLPRTAPL ELSASVAPGA GGTRVVTAQV HADSDPDGYA AGSFGDRRPV       600
     AGAVVTVAGQ QVDTDQDGRA TVVVPAGPSG PLEVGASAGD TFTPTRVEVS                  650
//

If you have problems or comments...

PBIL Back to PBIL home page