(data stored in ACNUC7421 zone)

EMBL: CP001854.PE247

CP001854.PE247       Location/Qualifiers
FT   CDS             256328..257188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_4204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48683"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F610"
FT                   /inference="similar to AA sequence:KEGG:Pmen_4204"
FT                   /protein_id="ADB48683.1"
FT                   /translation="MSRIRTLCAVVAALCCTLLVGAASASASPIEARYAASGPWAVSSA
FT                   TVRDASGRALYELRYPTDLGAGGVRHPIVTWGNGSIATPADYPGLLNHLASWGFAVVAS
FT                   TSSTTGKGTEMLAGAQYMVARDSDPASVFAGKLDTAHVAAVGHSQGAGGAVNATNLSRG
FT                   LIGTTVTYALPAAMWVSRGDEFDVAALRAPALFLGGRWDILISSPLVVDGYYRAAGGPA
FT                   AKAVLRDADHNTIQRTGGATLGYLTAWLKYRLEGDATARGAFAGSAPEINANPAWQDGA
FT                   QRALP"
     MSRIRTLCAV VAALCCTLLV GAASASASPI EARYAASGPW AVSSATVRDA SGRALYELRY        60
     PTDLGAGGVR HPIVTWGNGS IATPADYPGL LNHLASWGFA VVASTSSTTG KGTEMLAGAQ       120
     YMVARDSDPA SVFAGKLDTA HVAAVGHSQG AGGAVNATNL SRGLIGTTVT YALPAAMWVS       180
     RGDEFDVAAL RAPALFLGGR WDILISSPLV VDGYYRAAGG PAAKAVLRDA DHNTIQRTGG       240
     ATLGYLTAWL KYRLEGDATA RGAFAGSAPE INANPAWQDG AQRALP                      286
//

If you have problems or comments...

PBIL Back to PBIL home page