(data stored in ACNUC7421 zone)

EMBL: CP001854.PE248

CP001854.PE248       Location/Qualifiers
FT   CDS             complement(257201..257974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: COL5A2; collagen, type V, alpha 2; K06236
FT                   collagen, type I/II/III/V/XI, alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48684"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D3F611"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48684.1"
FT                   /translation="MKRLVAAALVAVLALACSVTAAQAGTTANKRTCAAKTKGRNTASR
FT                   RAACRAQRRKPARRGARGKQGRPGRAGRPGSQGAQGPAGAQGPAGPQGPAGPKGDRGEP
FT                   GPPQPGATRYAVVRDATSTPSTAFVPLGGPSLTITAPASGTIQVAASVEIADDDGLVSL
FT                   YEDGRPIAGQGDCAGLAAPGTLFTAYVTNPGGLSGPWGTPGTISSFGCATLGPPGPVTF
FT                   QTRPGEHMYELFYASCGCTTDPTFSNRKLWVTPMP"
     MKRLVAAALV AVLALACSVT AAQAGTTANK RTCAAKTKGR NTASRRAACR AQRRKPARRG        60
     ARGKQGRPGR AGRPGSQGAQ GPAGAQGPAG PQGPAGPKGD RGEPGPPQPG ATRYAVVRDA       120
     TSTPSTAFVP LGGPSLTITA PASGTIQVAA SVEIADDDGL VSLYEDGRPI AGQGDCAGLA       180
     APGTLFTAYV TNPGGLSGPW GTPGTISSFG CATLGPPGPV TFQTRPGEHM YELFYASCGC       240
     TTDPTFSNRK LWVTPMP                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page