(data stored in ACNUC7421 zone)

EMBL: CP001854.PE249

CP001854.PE249       Location/Qualifiers
FT   CDS             complement(258054..258788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0249"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; NodS family
FT                   protein; Methionine biosynthesis MetW protein;
FT                   Methyltransferase type 12; KEGG: rlt:Rleg2_0699
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48685"
FT                   /db_xref="GOA:D3F612"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F612"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48685.1"
FT                   /translation="MASSSDPTHDTVAADAAYDAMAAEYAAEGEENAYNALYERPATIA
FT                   LLPPVAGRDVLDAGCGSGPLSAWLVAHGARVTGFDTSPRMVELARARGLPGAAFSVGDL
FT                   GAPLTQFADDSFDAIVASLVLHYLHDWVAPLRELRRVLRPGGALVCSTHHPASDVELST
FT                   TGDYFATELLHDRWEKGGTTFDVRFWRRPLSAMLASIAEAGWRVDRLEEPQPLPACRER
FT                   DPEAWARLTTKPAFLFFRLVPA"
     MASSSDPTHD TVAADAAYDA MAAEYAAEGE ENAYNALYER PATIALLPPV AGRDVLDAGC        60
     GSGPLSAWLV AHGARVTGFD TSPRMVELAR ARGLPGAAFS VGDLGAPLTQ FADDSFDAIV       120
     ASLVLHYLHD WVAPLRELRR VLRPGGALVC STHHPASDVE LSTTGDYFAT ELLHDRWEKG       180
     GTTFDVRFWR RPLSAMLASI AEAGWRVDRL EEPQPLPACR ERDPEAWARL TTKPAFLFFR       240
     LVPA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page