(data stored in ACNUC7421 zone)

EMBL: CP001854.PE25

CP001854.PE25        Location/Qualifiers
FT   CDS             complement(28024..28761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0025"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: geo:Geob_0628
FT                   flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48461"
FT                   /db_xref="GOA:D3F3X8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X8"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48461.1"
FT                   /translation="MLQGLYSAAAGMAAQQQRIDGVSNDLANISTPGYKGVRVGFRDLL
FT                   YNSQGDQAGETVTAGAGSAASFIGRSQQQGAVLTTDQPLDVSIEGSGFFQLRRADGGIA
FT                   LTRDGSFRLDPLGRVTSSDGLLLSPPVTVPRNTPIDRIAIGADGTVRVNDGQQIGRIQL
FT                   VTVTSPDGLRALGDNRFAVTPESGAATATNGATLRQGTLEGSNVDMSDAMVDMMNAQRA
FT                   FQLASRAIHMQDQMLEVANQVKR"
     MLQGLYSAAA GMAAQQQRID GVSNDLANIS TPGYKGVRVG FRDLLYNSQG DQAGETVTAG        60
     AGSAASFIGR SQQQGAVLTT DQPLDVSIEG SGFFQLRRAD GGIALTRDGS FRLDPLGRVT       120
     SSDGLLLSPP VTVPRNTPID RIAIGADGTV RVNDGQQIGR IQLVTVTSPD GLRALGDNRF       180
     AVTPESGAAT ATNGATLRQG TLEGSNVDMS DAMVDMMNAQ RAFQLASRAI HMQDQMLEVA       240
     NQVKR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page