(data stored in ACNUC7421 zone)

EMBL: CP001854.PE250

CP001854.PE250       Location/Qualifiers
FT   CDS             258916..259377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0250"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   Polyketide cyclase/dehydrase; KEGG: pfl:PFL_4114 Aha1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48686"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3F613"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB48686.1"
FT                   /translation="MVSDQIEREVLIDAPVERVWSLVTEAEHVGRWFGDAGAEIDLRPG
FT                   GAMVMRWSEHGTSHGRVEAVEPPHRFAYRWAPFSHPLGDEPVEGNSTLVEFTLTADGDG
FT                   TLLKVRETGFADLALTAPEQTAAHEGNTRGWRMELDDLVAYAKQQSAVR"
     MVSDQIEREV LIDAPVERVW SLVTEAEHVG RWFGDAGAEI DLRPGGAMVM RWSEHGTSHG        60
     RVEAVEPPHR FAYRWAPFSH PLGDEPVEGN STLVEFTLTA DGDGTLLKVR ETGFADLALT       120
     APEQTAAHEG NTRGWRMELD DLVAYAKQQS AVR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page