(data stored in ACNUC7421 zone)

EMBL: CP001854.PE251

CP001854.PE251       Location/Qualifiers
FT   CDS             259374..259736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0251"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bac:BamMC406_3818 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48687"
FT                   /db_xref="GOA:D3F614"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F614"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB48687.1"
FT                   /translation="MIAPAADPAPVVFAALADPTRWNLLGTLAEQGEGTATTLAAQLPV
FT                   SRPAVIKHLVVLDRAGLVERRRHGREVRYTVRPERLDATARRMAEVAAAWDKRLAAIKR
FT                   LAEAAEGAASEDATSS"
     MIAPAADPAP VVFAALADPT RWNLLGTLAE QGEGTATTLA AQLPVSRPAV IKHLVVLDRA        60
     GLVERRRHGR EVRYTVRPER LDATARRMAE VAAAWDKRLA AIKRLAEAAE GAASEDATSS       120
//

If you have problems or comments...

PBIL Back to PBIL home page