(data stored in ACNUC7421 zone)

EMBL: CP001854.PE252

CP001854.PE252       Location/Qualifiers
FT   CDS             complement(259678..260910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0252"
FT                   /product="protein of unknown function DUF405"
FT                   /note="PFAM: protein of unknown function DUF405; protein of
FT                   unknown function DUF418; KEGG: bbr:BB3226 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48688"
FT                   /db_xref="GOA:D3F615"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F615"
FT                   /inference="protein motif:PFAM:PF04171"
FT                   /protein_id="ADB48688.1"
FT                   /translation="MLSPPAPATPPAVPPARRIAAVDALRGFALLGILVVNITFFGSAF
FT                   TLYEVPDPAFSSPLDDAANWFVAVFFTSKFYVLFSFLFGYSFTLQIDAAVRRGAAFVPR
FT                   FLRRLLGLFAIGAAHAVLLWQGDILTTYAVLGLVLLALRGLEPRRAVRIAVVLLLLSAS
FT                   FFALAGLDELSRGVEADTAQRVADATAATDAWRGSIGEVISQRISELPTVAGVIGLLQA
FT                   PTALAMFLLGLAAGKRRLFADLDALRPHLRRMVRIGLPVGLAGSVVYTYLTIEHAGTGW
FT                   ATFAVAFDVLTAPLLSAAYAAVLLLAVQARHGHRLTAVLAPTGRMALSNYLLQSIACCL
FT                   IFTGYGLGLVGRLAPAAVLGVAAAVYAAQLATSAWWLGRHPYGPAEWLLRGFTNWSRPR
FT                   WRLPPPPRPGA"
     MLSPPAPATP PAVPPARRIA AVDALRGFAL LGILVVNITF FGSAFTLYEV PDPAFSSPLD        60
     DAANWFVAVF FTSKFYVLFS FLFGYSFTLQ IDAAVRRGAA FVPRFLRRLL GLFAIGAAHA       120
     VLLWQGDILT TYAVLGLVLL ALRGLEPRRA VRIAVVLLLL SASFFALAGL DELSRGVEAD       180
     TAQRVADATA ATDAWRGSIG EVISQRISEL PTVAGVIGLL QAPTALAMFL LGLAAGKRRL       240
     FADLDALRPH LRRMVRIGLP VGLAGSVVYT YLTIEHAGTG WATFAVAFDV LTAPLLSAAY       300
     AAVLLLAVQA RHGHRLTAVL APTGRMALSN YLLQSIACCL IFTGYGLGLV GRLAPAAVLG       360
     VAAAVYAAQL ATSAWWLGRH PYGPAEWLLR GFTNWSRPRW RLPPPPRPGA                  410
//

If you have problems or comments...

PBIL Back to PBIL home page