(data stored in ACNUC7421 zone)

EMBL: CP001854.PE253

CP001854.PE253       Location/Qualifiers
FT   CDS             complement(261024..261680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0253"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: scl:sce5431 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48689"
FT                   /db_xref="GOA:D3F616"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F616"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48689.1"
FT                   /translation="MSPALRVVVADDHALARAGVRMILESQPDIAVVGEAGDGHAAVAA
FT                   ADRLRPDVVLMDTHLPRLDGVAATRRLAAHRVLLLTSGSPEERLVEALRAGARGFLLKH
FT                   ASAGDLVAAVRAVAAGDMLLSPAATRALFERIAPMLHLDAAPPPSALGELTERELDVLR
FT                   LLARGLSNGEIAAQLFVSGATVKTHVSHLLRKLCLRDRVQAVVFAYDSGLVQPRG"
     MSPALRVVVA DDHALARAGV RMILESQPDI AVVGEAGDGH AAVAAADRLR PDVVLMDTHL        60
     PRLDGVAATR RLAAHRVLLL TSGSPEERLV EALRAGARGF LLKHASAGDL VAAVRAVAAG       120
     DMLLSPAATR ALFERIAPML HLDAAPPPSA LGELTERELD VLRLLARGLS NGEIAAQLFV       180
     SGATVKTHVS HLLRKLCLRD RVQAVVFAYD SGLVQPRG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page