(data stored in ACNUC7421 zone)

EMBL: CP001854.PE254

CP001854.PE254       Location/Qualifiers
FT   CDS             complement(261677..262273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0254"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_1087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48690"
FT                   /db_xref="GOA:D3F617"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D3F617"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48690.1"
FT                   /translation="MTPSPVDHDARREQLTRVLLALVAERGLEGASVRAVASAAGVSIG
FT                   TVQHYFRSKDEMLLFAFRQTGSDLTERAERIARRALSVRAAIRGILLELLPLDARREAE
FT                   ARVGIAFAAHAMTAPRLAGVLRDDLDELRRELADAFAQAKVADPPQAASAAMALVDGLA
FT                   TQLLFGSAAFGADDAVAVLDAHLEHALARRRRRRA"
     MTPSPVDHDA RREQLTRVLL ALVAERGLEG ASVRAVASAA GVSIGTVQHY FRSKDEMLLF        60
     AFRQTGSDLT ERAERIARRA LSVRAAIRGI LLELLPLDAR REAEARVGIA FAAHAMTAPR       120
     LAGVLRDDLD ELRRELADAF AQAKVADPPQ AASAAMALVD GLATQLLFGS AAFGADDAVA       180
     VLDAHLEHAL ARRRRRRA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page