(data stored in ACNUC7421 zone)

EMBL: CP001854.PE255

CP001854.PE255       Location/Qualifiers
FT   CDS             complement(262328..263791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0255"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A3935 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48691"
FT                   /db_xref="GOA:D3F618"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F618"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48691.1"
FT                   /translation="MSSQHNTSSPHHARRWWVLALIGVAQLMVVLDATIVNIALPSAQS
FT                   ALEFSDANRQWIVTAYALAFGSLLLIGGRIGDLFGRKRVFIAGLLGFAVASAIGGAAQS
FT                   FGMLVFARALQGVFGALLAPAALSLLTTTFTDPGERGRAFGIFGAIAGSGAAIGLLLGG
FT                   VLTEYLSWRWCLYVNLLFAVPTAFAAITLLHDEAHPAKPRLDIPGTLTSALGLFALVYG
FT                   FAEAESEGWGASTTIAFLAAGVALLAVFVWLQTRTEHPLLPLRVVRDRDRGGAYFAIGI
FT                   TGAGMFGVFLFLTYYLQQTLGFSPVETGLAFLPLSFAIMLTATSATAQLMPRFGHKPLI
FT                   VTGLAMSAAGMVLLAQVGVDSEYLTHVLPGLVVMGLGLGLVFAPGMSIATIGVDPHDAG
FT                   VASAMVNTTQQVGGSIGTALLSTLFASAVSGFIADNGPRAAGEAAVHGYTTAFWWSAAI
FT                   FAVGAVVSLLLLKSGVKQADPAAEPVLVH"
     MSSQHNTSSP HHARRWWVLA LIGVAQLMVV LDATIVNIAL PSAQSALEFS DANRQWIVTA        60
     YALAFGSLLL IGGRIGDLFG RKRVFIAGLL GFAVASAIGG AAQSFGMLVF ARALQGVFGA       120
     LLAPAALSLL TTTFTDPGER GRAFGIFGAI AGSGAAIGLL LGGVLTEYLS WRWCLYVNLL       180
     FAVPTAFAAI TLLHDEAHPA KPRLDIPGTL TSALGLFALV YGFAEAESEG WGASTTIAFL       240
     AAGVALLAVF VWLQTRTEHP LLPLRVVRDR DRGGAYFAIG ITGAGMFGVF LFLTYYLQQT       300
     LGFSPVETGL AFLPLSFAIM LTATSATAQL MPRFGHKPLI VTGLAMSAAG MVLLAQVGVD       360
     SEYLTHVLPG LVVMGLGLGL VFAPGMSIAT IGVDPHDAGV ASAMVNTTQQ VGGSIGTALL       420
     STLFASAVSG FIADNGPRAA GEAAVHGYTT AFWWSAAIFA VGAVVSLLLL KSGVKQADPA       480
     AEPVLVH                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page