(data stored in ACNUC7421 zone)

EMBL: CP001854.PE256

CP001854.PE256       Location/Qualifiers
FT   CDS             263927..264610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0256"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ara:Arad_4588
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48692"
FT                   /db_xref="GOA:D3F619"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3F619"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48692.1"
FT                   /translation="MSTAAEPARDRPLRRDAERNRRRILDAATEVFADRGLGVTMDDIA
FT                   AHAGVGVGTVYRRFANKDQLIDALFYERIDALARLGEEGLTHADAWEGLVFFMEEAIGQ
FT                   QARDRGLKELLFGSGRGEERVAHARTRMAPVVFALVDRARAAGVLRPDVEGTDVPVLQL
FT                   MLGTVVDFSRDVEPELWRRYLTLMLDGLRVRRDDDTPLPLPPLDEHGTERAMASWQVPR
FT                   RGPVS"
     MSTAAEPARD RPLRRDAERN RRRILDAATE VFADRGLGVT MDDIAAHAGV GVGTVYRRFA        60
     NKDQLIDALF YERIDALARL GEEGLTHADA WEGLVFFMEE AIGQQARDRG LKELLFGSGR       120
     GEERVAHART RMAPVVFALV DRARAAGVLR PDVEGTDVPV LQLMLGTVVD FSRDVEPELW       180
     RRYLTLMLDG LRVRRDDDTP LPLPPLDEHG TERAMASWQV PRRGPVS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page