(data stored in ACNUC7421 zone)

EMBL: CP001854.PE258

CP001854.PE258       Location/Qualifiers
FT   CDS             complement(264819..265190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpu:KP1_3163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48694"
FT                   /db_xref="UniProtKB/TrEMBL:D3F621"
FT                   /inference="similar to AA sequence:KEGG:KP1_3163"
FT                   /protein_id="ADB48694.1"
FT                   /translation="MPWPPAIGDLLPLAEHACGIRRKLLTYSLAHEHERGGDKARAFLL
FT                   ALSIERAHVDHLEAELRAGVRVTPISRVDVKRHGFLFQVRIPVRGVMLHRNRVLPVTTG
FT                   WHVPEEGMAPRLASAYLKS"
     MPWPPAIGDL LPLAEHACGI RRKLLTYSLA HEHERGGDKA RAFLLALSIE RAHVDHLEAE        60
     LRAGVRVTPI SRVDVKRHGF LFQVRIPVRG VMLHRNRVLP VTTGWHVPEE GMAPRLASAY       120
     LKS                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page