(data stored in ACNUC7421 zone)

EMBL: CP001854.PE259

CP001854.PE259       Location/Qualifiers
FT   CDS             265428..266882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0259"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: peptidase S41; KEGG:
FT                   hch:HCH_04120 periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48695"
FT                   /db_xref="GOA:D3F622"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3F622"
FT                   /inference="protein motif:PFAM:PF03572"
FT                   /protein_id="ADB48695.1"
FT                   /translation="MIRSPHPAARRAVRLTAATAALTFALSAAACQLDVDTSDAATTAP
FT                   AARDAPQLAGTWRSVGYGWALEARGARIRMYDVTRSGCTPASVFRAHARGAAVRLTATD
FT                   GWGALDAVAGRRAGSVVLRPVGSVGVVTLRRIRRPPARCDAAPHRDQRATTRALTETFA
FT                   EQYPFFARRGVDWRRTTRALERATRTPLPPKQLFELYRRALAPLHDAHVSLLDPGSETE
FT                   WTGRRPDPHPLAPADHARIQQIVETRLGARLRSFANGRIFYARTHSGIGYLRIVSFGGY
FT                   ARAAATADGSRRDAQVLARTLDGILGGADAPRSGLLVDVRENVGGYDALQLVVAARLTA
FT                   TRYLAFRKATQISGGRTPRRTRPQAIDVVPAAGRPGWHGPVALLTGRDTESAGETFVLS
FT                   LIGRTPAVARIGETTQGVFSDQLVRRLPNGWTFGLPSEIYTAPDGTVYEGRGIPPTDAQ
FT                   PVFTPEDLATRRDPALERALSALGGR"
     MIRSPHPAAR RAVRLTAATA ALTFALSAAA CQLDVDTSDA ATTAPAARDA PQLAGTWRSV        60
     GYGWALEARG ARIRMYDVTR SGCTPASVFR AHARGAAVRL TATDGWGALD AVAGRRAGSV       120
     VLRPVGSVGV VTLRRIRRPP ARCDAAPHRD QRATTRALTE TFAEQYPFFA RRGVDWRRTT       180
     RALERATRTP LPPKQLFELY RRALAPLHDA HVSLLDPGSE TEWTGRRPDP HPLAPADHAR       240
     IQQIVETRLG ARLRSFANGR IFYARTHSGI GYLRIVSFGG YARAAATADG SRRDAQVLAR       300
     TLDGILGGAD APRSGLLVDV RENVGGYDAL QLVVAARLTA TRYLAFRKAT QISGGRTPRR       360
     TRPQAIDVVP AAGRPGWHGP VALLTGRDTE SAGETFVLSL IGRTPAVARI GETTQGVFSD       420
     QLVRRLPNGW TFGLPSEIYT APDGTVYEGR GIPPTDAQPV FTPEDLATRR DPALERALSA       480
     LGGR                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page