(data stored in ACNUC7421 zone)

EMBL: CP001854.PE26

CP001854.PE26        Location/Qualifiers
FT   CDS             complement(28889..29587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0026"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ppd:Ppro_3448
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48462"
FT                   /db_xref="GOA:D3F3X9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3X9"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48462.1"
FT                   /translation="MERGLYIAASGMIAEQMRQDAIANDLANASTPGYKADRITQASFG
FT                   DLLLSNSNTGQVIGPLGTGAYADSKVTDLRPQATRVTEEPLDLAIVGEGWFGVQTPEGV
FT                   RYTRNGQFSASPQGQLIDQLGRPVLGPGGQPVQLDARGHVRPGSVGVFALANARKEGDN
FT                   YFTGAAGGQATGQVEIGALEGSGIDPTRTMVDMIASFRAYEAGQKVITTIDDTLRRTST
FT                   QVGNATGGSF"
     MERGLYIAAS GMIAEQMRQD AIANDLANAS TPGYKADRIT QASFGDLLLS NSNTGQVIGP        60
     LGTGAYADSK VTDLRPQATR VTEEPLDLAI VGEGWFGVQT PEGVRYTRNG QFSASPQGQL       120
     IDQLGRPVLG PGGQPVQLDA RGHVRPGSVG VFALANARKE GDNYFTGAAG GQATGQVEIG       180
     ALEGSGIDPT RTMVDMIASF RAYEAGQKVI TTIDDTLRRT STQVGNATGG SF               232
//

If you have problems or comments...

PBIL Back to PBIL home page