(data stored in ACNUC7421 zone)

EMBL: CP001854.PE260

CP001854.PE260       Location/Qualifiers
FT   CDS             266898..267629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48696"
FT                   /db_xref="UniProtKB/TrEMBL:D3F623"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48696.1"
FT                   /translation="MTARLVAVVVLALVAASGFVLAARVRTVGDTTALHTLPAPERLTI
FT                   DDEEGDVAVVAEARDDVLVETRSRWTGARPAARVAAGGDVLRLTGRCDRLDVRLVASRD
FT                   WRWGSECAVSYRVRVPVGLDVRVSTGTGDVRLVGLAGAIDAEAHDGDVTAVGLRSPHVT
FT                   LRATGAGAIRARFAAVPGAVDARAEGGAVRLALPPGRYHLSADAPRGRTWIGAGIDADP
FT                   AGRSTVGASAGDGDVTVEAAR"
     MTARLVAVVV LALVAASGFV LAARVRTVGD TTALHTLPAP ERLTIDDEEG DVAVVAEARD        60
     DVLVETRSRW TGARPAARVA AGGDVLRLTG RCDRLDVRLV ASRDWRWGSE CAVSYRVRVP       120
     VGLDVRVSTG TGDVRLVGLA GAIDAEAHDG DVTAVGLRSP HVTLRATGAG AIRARFAAVP       180
     GAVDARAEGG AVRLALPPGR YHLSADAPRG RTWIGAGIDA DPAGRSTVGA SAGDGDVTVE       240
     AAR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page