(data stored in ACNUC7421 zone)

EMBL: CP001854.PE261

CP001854.PE261       Location/Qualifiers
FT   CDS             267626..268915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0261"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48697"
FT                   /db_xref="GOA:D3F624"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F624"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADB48697.1"
FT                   /translation="MSGAAGGAPGAVASEPRRAAAARAALGAVARAVAAPLSSARTWTA
FT                   AADLVLGAAAALLVAFVVAAAAERGLTAALVASALMLLLAAAVSGASGALDRRLANALL
FT                   DAGIEAPQPASARPSWRAYAWTLLRLPLALVALLALVLTVFVALLLVLAPFSGGLGDAP
FT                   LLAQAWCVLAGIALGLLALHGIDAWRWLHVRLARALLGRSGAQRLVALRERAERLAARA
FT                   ELARDLHDSVGHAVTAATLQAAAARRVLARDPQFAADALKAIEQQGRRALDELDHVLAS
FT                   LRDEDDGAARGARAAPRRPAPGLGDVDRLLERTRAAGVPLTVVQRGERDGIAPVLDREA
FT                   YRVLQEGLTNVLRHAAGATTRVLVEAASDQLAIVVDDDGGRALDPRRRGGGSGLRAAGE
FT                   RVRALGGTLEAGPVDGGGYRLRAMLPLRRR"
     MSGAAGGAPG AVASEPRRAA AARAALGAVA RAVAAPLSSA RTWTAAADLV LGAAAALLVA        60
     FVVAAAAERG LTAALVASAL MLLLAAAVSG ASGALDRRLA NALLDAGIEA PQPASARPSW       120
     RAYAWTLLRL PLALVALLAL VLTVFVALLL VLAPFSGGLG DAPLLAQAWC VLAGIALGLL       180
     ALHGIDAWRW LHVRLARALL GRSGAQRLVA LRERAERLAA RAELARDLHD SVGHAVTAAT       240
     LQAAAARRVL ARDPQFAADA LKAIEQQGRR ALDELDHVLA SLRDEDDGAA RGARAAPRRP       300
     APGLGDVDRL LERTRAAGVP LTVVQRGERD GIAPVLDREA YRVLQEGLTN VLRHAAGATT       360
     RVLVEAASDQ LAIVVDDDGG RALDPRRRGG GSGLRAAGER VRALGGTLEA GPVDGGGYRL       420
     RAMLPLRRR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page