(data stored in ACNUC7421 zone)

EMBL: CP001854.PE262

CP001854.PE262       Location/Qualifiers
FT   CDS             268912..269589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0262"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48698"
FT                   /db_xref="GOA:D3F625"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F625"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48698.1"
FT                   /translation="MTAADEREPIRLLIADDDGLVRGGLRTLLANEPGLAVVGEAADGF
FT                   AAVRAAQELDPDVVLMDVRMPRLDGIEATRRVVAGGRARVLVVTTFEHDDYVYEALRAG
FT                   ASGFVLKRAEPEELVQAVRIVAGGESLVFPQLTRALIARSVQPGAGDGGARLLTVLTER
FT                   EAEILRLVARGMSNADVADELVLAVHTVKTHVARILAKLAVRDRTQAVVVAYESGFVRP
FT                   GDA"
     MTAADEREPI RLLIADDDGL VRGGLRTLLA NEPGLAVVGE AADGFAAVRA AQELDPDVVL        60
     MDVRMPRLDG IEATRRVVAG GRARVLVVTT FEHDDYVYEA LRAGASGFVL KRAEPEELVQ       120
     AVRIVAGGES LVFPQLTRAL IARSVQPGAG DGGARLLTVL TEREAEILRL VARGMSNADV       180
     ADELVLAVHT VKTHVARILA KLAVRDRTQA VVVAYESGFV RPGDA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page