(data stored in ACNUC7421 zone)

EMBL: CP001854.PE263

CP001854.PE263       Location/Qualifiers
FT   CDS             complement(269553..270311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_1192 antifreeze glycopeptide AFGP
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48699"
FT                   /db_xref="UniProtKB/TrEMBL:D3F626"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48699.1"
FT                   /translation="MPDAGRSEPTSTGPWGPDGRRAAVAIVFAGLAGTTPEHPVTPALP
FT                   TLLRVLGDRDLPATFCVEAPIAASEPFALSMVGVGAHELAALAPPSGSAAPALDALAQE
FT                   RFSAAGVLLPAGADADPSVPTSLRDELTRAGVSYLAAPAHAADETARLDGDLVRIPIAL
FT                   DDGDDPAPSAFHLRFQATVGSTLARGGLLVVALRPSCFERQDALDVLVESLDLLAGLRR
FT                   AERLWTPRLRELADALGADQASPGRTKPLS"
     MPDAGRSEPT STGPWGPDGR RAAVAIVFAG LAGTTPEHPV TPALPTLLRV LGDRDLPATF        60
     CVEAPIAASE PFALSMVGVG AHELAALAPP SGSAAPALDA LAQERFSAAG VLLPAGADAD       120
     PSVPTSLRDE LTRAGVSYLA APAHAADETA RLDGDLVRIP IALDDGDDPA PSAFHLRFQA       180
     TVGSTLARGG LLVVALRPSC FERQDALDVL VESLDLLAGL RRAERLWTPR LRELADALGA       240
     DQASPGRTKP LS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page