(data stored in ACNUC7421 zone)

EMBL: CP001854.PE264

CP001854.PE264       Location/Qualifiers
FT   CDS             270310..270942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0264"
FT                   /product="putative phospholipase/carboxylesterase family
FT                   protein"
FT                   /note="KEGG: bbt:BBta_7203 putative
FT                   phospholipase/carboxylesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48700"
FT                   /db_xref="GOA:D3F627"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F627"
FT                   /inference="similar to AA sequence:KEGG:BBta_7203"
FT                   /protein_id="ADB48700.1"
FT                   /translation="MICIVPDLAFDHHFEPGTAGDTLLLLHATGGDERQLVPLGRQLAP
FT                   GAALLAPRGQVLENGRVRRFFARRGPADLDLDDLRERTTGLAAFVGDTLAQRELDPARV
FT                   TALGYSNGANVAVELLFSHPGLLHAAALLRPVLAYEPEQPLTGLDRTSVLIAVGDADPY
FT                   GPSEQIERLTELLREGGADVEVAVQPAGHELTEGDFTAVGDWLARVR"
     MICIVPDLAF DHHFEPGTAG DTLLLLHATG GDERQLVPLG RQLAPGAALL APRGQVLENG        60
     RVRRFFARRG PADLDLDDLR ERTTGLAAFV GDTLAQRELD PARVTALGYS NGANVAVELL       120
     FSHPGLLHAA ALLRPVLAYE PEQPLTGLDR TSVLIAVGDA DPYGPSEQIE RLTELLREGG       180
     ADVEVAVQPA GHELTEGDFT AVGDWLARVR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page