(data stored in ACNUC7421 zone)

EMBL: CP001854.PE265

CP001854.PE265       Location/Qualifiers
FT   CDS             complement(270939..272648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0265"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48701"
FT                   /db_xref="GOA:D3F628"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3F628"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADB48701.1"
FT                   /translation="MTDASSLNPQQRAAALERMANETFEVVVIGGGAVGAGAALDAVTR
FT                   GLSVALVEARDFASGTSSRSSKLIHGGLRYLEQLDFRLVREALRERSLLLNTLAPHLVK
FT                   PVPFLYPLRQRFFERPYVEAGMLLYDTMAGHDGVPRHRHFTRRGALRIAPGLKPDSLIG
FT                   AIQYYDGKVDDARCTMTVARTAAHYGAAVANNAPVVGFLREGERVTGVRVHDLATGRDV
FT                   EVRAQQVVNATGVWTDDVQHLVRERGKFRVRASKGIHVVVPRDRIQLDTGLILRTEKSV
FT                   LFVIPWGRHWIVGTTDTDWELSKAHPAASRTDIDYVLEHANAVLAQPLTHEDVEGVYAG
FT                   LRPLLSGESESTSKLSREHSVAVPVPGLVAVAGGKYTTYRVMGKDAIDAAARGLDRSVP
FT                   ESVTHRTELLGADGYRALWNGRHRLAKQSGLHPARIEHLLDRYGSCIHDLLALVAERPE
FT                   LAEPLPGADDYLAVEVHYAAASEGARHLDDVLARRTRISIETFHRGVETAPVAARLMGD
FT                   VLGWSRADVRREVDTYTARVEAERRSQEQPDDEAADEVRTAAPDLLAGVGDA"
     MTDASSLNPQ QRAAALERMA NETFEVVVIG GGAVGAGAAL DAVTRGLSVA LVEARDFASG        60
     TSSRSSKLIH GGLRYLEQLD FRLVREALRE RSLLLNTLAP HLVKPVPFLY PLRQRFFERP       120
     YVEAGMLLYD TMAGHDGVPR HRHFTRRGAL RIAPGLKPDS LIGAIQYYDG KVDDARCTMT       180
     VARTAAHYGA AVANNAPVVG FLREGERVTG VRVHDLATGR DVEVRAQQVV NATGVWTDDV       240
     QHLVRERGKF RVRASKGIHV VVPRDRIQLD TGLILRTEKS VLFVIPWGRH WIVGTTDTDW       300
     ELSKAHPAAS RTDIDYVLEH ANAVLAQPLT HEDVEGVYAG LRPLLSGESE STSKLSREHS       360
     VAVPVPGLVA VAGGKYTTYR VMGKDAIDAA ARGLDRSVPE SVTHRTELLG ADGYRALWNG       420
     RHRLAKQSGL HPARIEHLLD RYGSCIHDLL ALVAERPELA EPLPGADDYL AVEVHYAAAS       480
     EGARHLDDVL ARRTRISIET FHRGVETAPV AARLMGDVLG WSRADVRREV DTYTARVEAE       540
     RRSQEQPDDE AADEVRTAAP DLLAGVGDA                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page