(data stored in ACNUC7421 zone)

EMBL: CP001854.PE266

CP001854.PE266       Location/Qualifiers
FT   CDS             complement(272695..273096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48702"
FT                   /db_xref="GOA:D3F629"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3F629"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48702.1"
FT                   /translation="MLFGDEHVKRYEETDGAEGHEWQGTTSLILTTRGRKSGEERKAAL
FT                   IYQRDGDDLLVVASRGGAPQPPAWFLNLEADPEVGVQVEGDRFTARARTATPEEKPGMW
FT                   RKMTAVWPDYDTYQTKTDREIPVVVLERV"
     MLFGDEHVKR YEETDGAEGH EWQGTTSLIL TTRGRKSGEE RKAALIYQRD GDDLLVVASR        60
     GGAPQPPAWF LNLEADPEVG VQVEGDRFTA RARTATPEEK PGMWRKMTAV WPDYDTYQTK       120
     TDREIPVVVL ERV                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page